Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 64195..64449 Replicon plasmid 2
Accession NZ_OU342920
Organism Escherichia coli isolate UR21/11-869

Toxin (Protein)


Gene name srnB Uniprot ID Q0H0B2
Locus tag LIX80_RS24445 Protein ID WP_001300273.1
Coordinates 64195..64344 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 64388..64449 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LIX80_RS24415 (60338) 60338..60493 + 156 Protein_70 IS110 family transposase -
LIX80_RS24420 (60889) 60889..61140 - 252 WP_001315600.1 HTH domain-containing protein -
LIX80_RS24425 (62491) 62491..63348 - 858 WP_000131011.1 incFII family plasmid replication initiator RepA -
LIX80_RS24430 (63341) 63341..63415 - 75 WP_001365705.1 RepA leader peptide Tap -
LIX80_RS24435 (63464) 63464..63589 + 126 WP_071590472.1 replication protein RepA -
LIX80_RS24440 (63666) 63666..63911 - 246 WP_226397356.1 replication regulatory protein RepA -
LIX80_RS24445 (64195) 64195..64344 - 150 WP_001300273.1 Hok/Gef family protein Toxin
- (64388) 64388..64449 + 62 NuclAT_2 - Antitoxin
- (64388) 64388..64449 + 62 NuclAT_2 - Antitoxin
- (64388) 64388..64449 + 62 NuclAT_2 - Antitoxin
- (64388) 64388..64449 + 62 NuclAT_2 - Antitoxin
LIX80_RS24450 (65109) 65109..65560 - 452 Protein_77 thermonuclease family protein -
LIX80_RS24455 (66337) 66337..66531 - 195 WP_226397357.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..66803 66803


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5554.72 Da        Isoelectric Point: 8.7678

>T294755 WP_001300273.1 NZ_OU342920:c64344-64195 [Escherichia coli]
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT294755 NZ_OU342920:64388-64449 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q0H0B2

Antitoxin

Download structure file

References