Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 64195..64449 | Replicon | plasmid 2 |
| Accession | NZ_OU342920 | ||
| Organism | Escherichia coli isolate UR21/11-869 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | Q0H0B2 |
| Locus tag | LIX80_RS24445 | Protein ID | WP_001300273.1 |
| Coordinates | 64195..64344 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 64388..64449 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIX80_RS24415 (60338) | 60338..60493 | + | 156 | Protein_70 | IS110 family transposase | - |
| LIX80_RS24420 (60889) | 60889..61140 | - | 252 | WP_001315600.1 | HTH domain-containing protein | - |
| LIX80_RS24425 (62491) | 62491..63348 | - | 858 | WP_000131011.1 | incFII family plasmid replication initiator RepA | - |
| LIX80_RS24430 (63341) | 63341..63415 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| LIX80_RS24435 (63464) | 63464..63589 | + | 126 | WP_071590472.1 | replication protein RepA | - |
| LIX80_RS24440 (63666) | 63666..63911 | - | 246 | WP_226397356.1 | replication regulatory protein RepA | - |
| LIX80_RS24445 (64195) | 64195..64344 | - | 150 | WP_001300273.1 | Hok/Gef family protein | Toxin |
| - (64388) | 64388..64449 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (64388) | 64388..64449 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (64388) | 64388..64449 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (64388) | 64388..64449 | + | 62 | NuclAT_2 | - | Antitoxin |
| LIX80_RS24450 (65109) | 65109..65560 | - | 452 | Protein_77 | thermonuclease family protein | - |
| LIX80_RS24455 (66337) | 66337..66531 | - | 195 | WP_226397357.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..66803 | 66803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5554.72 Da Isoelectric Point: 8.7678
>T294755 WP_001300273.1 NZ_OU342920:c64344-64195 [Escherichia coli]
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT294755 NZ_OU342920:64388-64449 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|