Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 25589..26012 | Replicon | plasmid 2 |
Accession | NZ_OU342920 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | LIX80_RS24230 | Protein ID | WP_229484968.1 |
Coordinates | 25589..25708 (-) | Length | 40 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 25796..26012 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS24195 (20666) | 20666..20893 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
LIX80_RS24200 (20987) | 20987..21673 | - | 687 | WP_000332492.1 | PAS domain-containing protein | - |
LIX80_RS24205 (21863) | 21863..22246 | - | 384 | WP_000124980.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
LIX80_RS24210 (22568) | 22568..23170 | + | 603 | WP_000243717.1 | transglycosylase SLT domain-containing protein | - |
LIX80_RS24215 (23465) | 23465..24286 | - | 822 | WP_001234477.1 | DUF932 domain-containing protein | - |
LIX80_RS24220 (24403) | 24403..24690 | - | 288 | WP_000107547.1 | hypothetical protein | - |
LIX80_RS24225 (24990) | 24990..25296 | + | 307 | Protein_33 | hypothetical protein | - |
LIX80_RS24230 (25589) | 25589..25708 | - | 120 | WP_229484968.1 | Hok/Gef family protein | Toxin |
LIX80_RS24235 (25656) | 25656..25808 | - | 153 | Protein_35 | FlmC family protein | - |
- (25796) | 25796..26012 | - | 217 | NuclAT_0 | - | Antitoxin |
- (25796) | 25796..26012 | - | 217 | NuclAT_0 | - | Antitoxin |
- (25796) | 25796..26012 | - | 217 | NuclAT_0 | - | Antitoxin |
- (25796) | 25796..26012 | - | 217 | NuclAT_0 | - | Antitoxin |
LIX80_RS24240 (25981) | 25981..26743 | - | 763 | Protein_36 | plasmid SOS inhibition protein A | - |
LIX80_RS24245 (26740) | 26740..27147 | - | 408 | WP_001261250.1 | conjugation system SOS inhibitor PsiB | - |
LIX80_RS24250 (27308) | 27308..27487 | + | 180 | WP_000618107.1 | hypothetical protein | - |
LIX80_RS24255 (27571) | 27571..27963 | - | 393 | WP_000272016.1 | plasmid partitioning/stability family protein | - |
LIX80_RS24260 (27967) | 27967..28941 | - | 975 | WP_021534625.1 | plasmid segregation protein ParM | - |
LIX80_RS24265 (29181) | 29181..29555 | - | 375 | WP_000752650.1 | hypothetical protein | - |
LIX80_RS24270 (29555) | 29555..30187 | - | 633 | WP_000312330.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..66803 | 66803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 40 a.a. Molecular weight: 4455.25 Da Isoelectric Point: 8.2691
>T294751 WP_229484968.1 NZ_OU342920:c25708-25589 [Escherichia coli]
VCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESSGK
VCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESSGK
Download Length: 120 bp
Antitoxin
Download Length: 217 bp
>AT294751 NZ_OU342920:c26012-25796 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTCTTTTCAGGAAAAGTGAGTGTGGTCAGCGCGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTCTTTTCAGGAAAAGTGAGTGTGGTCAGCGCGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTATCCTGTCGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTCATTAACCCACGAGGCCTCTGCATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|