Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 10945..11199 | Replicon | plasmid 2 |
| Accession | NZ_OU342920 | ||
| Organism | Escherichia coli isolate UR21/11-869 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | Q0H0B2 |
| Locus tag | LIX80_RS24125 | Protein ID | WP_001300273.1 |
| Coordinates | 10945..11094 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 11138..11199 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIX80_RS24095 (7090) | 7090..7245 | + | 156 | Protein_7 | IS110 family transposase | - |
| LIX80_RS24100 (7641) | 7641..7892 | - | 252 | WP_001315600.1 | HTH domain-containing protein | - |
| LIX80_RS24105 (9242) | 9242..10099 | - | 858 | WP_000131011.1 | incFII family plasmid replication initiator RepA | - |
| LIX80_RS24110 (10092) | 10092..10166 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| LIX80_RS24115 (10215) | 10215..10340 | + | 126 | WP_071590472.1 | replication protein RepA | - |
| LIX80_RS24120 (10413) | 10413..10661 | - | 249 | WP_000083838.1 | replication regulatory protein RepA | - |
| LIX80_RS24125 (10945) | 10945..11094 | - | 150 | WP_001300273.1 | Hok/Gef family protein | Toxin |
| - (11138) | 11138..11199 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (11138) | 11138..11199 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (11138) | 11138..11199 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (11138) | 11138..11199 | + | 62 | NuclAT_1 | - | Antitoxin |
| LIX80_RS24130 (11859) | 11859..12320 | - | 462 | WP_000760077.1 | thermonuclease family protein | - |
| LIX80_RS24135 (13063) | 13063..13266 | - | 204 | WP_001327131.1 | hypothetical protein | - |
| LIX80_RS24140 (13421) | 13421..13978 | - | 558 | WP_000139319.1 | fertility inhibition protein FinO | - |
| LIX80_RS24145 (14081) | 14081..14941 | - | 861 | WP_000704512.1 | alpha/beta hydrolase | - |
| LIX80_RS24150 (15000) | 15000..15746 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..66803 | 66803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5554.72 Da Isoelectric Point: 8.7678
>T294747 WP_001300273.1 NZ_OU342920:c11094-10945 [Escherichia coli]
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGVLAVCATVLCFLLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT294747 NZ_OU342920:11138-11199 [Escherichia coli]
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
