Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2288325..2289124 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | U9XVR9 |
Locus tag | LIX80_RS11025 | Protein ID | WP_000347267.1 |
Coordinates | 2288325..2288789 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | LIX80_RS11030 | Protein ID | WP_001307405.1 |
Coordinates | 2288789..2289124 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS10995 (2283326) | 2283326..2283760 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LIX80_RS11000 (2283778) | 2283778..2284656 | - | 879 | WP_123129705.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LIX80_RS11005 (2284646) | 2284646..2285425 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LIX80_RS11010 (2285436) | 2285436..2285909 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LIX80_RS11015 (2285932) | 2285932..2287212 | - | 1281 | WP_000681947.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LIX80_RS11020 (2287461) | 2287461..2288270 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
LIX80_RS11025 (2288325) | 2288325..2288789 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LIX80_RS11030 (2288789) | 2288789..2289124 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LIX80_RS11035 (2289273) | 2289273..2290844 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
LIX80_RS11040 (2291219) | 2291219..2292553 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
LIX80_RS11045 (2292569) | 2292569..2293339 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T294736 WP_000347267.1 NZ_OU342919:c2288789-2288325 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |