Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 1496001..1496603 | Replicon | chromosome |
Accession | NZ_OU342919 | ||
Organism | Escherichia coli isolate UR21/11-869 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | LIX80_RS07160 | Protein ID | WP_000897305.1 |
Coordinates | 1496292..1496603 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LIX80_RS07155 | Protein ID | WP_000356397.1 |
Coordinates | 1496001..1496291 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LIX80_RS07135 (1492044) | 1492044..1493221 | + | 1178 | WP_085968792.1 | IS3 family transposase | - |
LIX80_RS07140 (1493508) | 1493508..1494488 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
LIX80_RS07145 (1494717) | 1494717..1494959 | - | 243 | WP_001086388.1 | protein YiiF | - |
LIX80_RS07150 (1495178) | 1495178..1495396 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
LIX80_RS07155 (1496001) | 1496001..1496291 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LIX80_RS07160 (1496292) | 1496292..1496603 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
LIX80_RS07165 (1496832) | 1496832..1497740 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
LIX80_RS07170 (1497804) | 1497804..1498745 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
LIX80_RS07175 (1498790) | 1498790..1499227 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
LIX80_RS07180 (1499224) | 1499224..1500096 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
LIX80_RS07185 (1500090) | 1500090..1500689 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
LIX80_RS07190 (1500788) | 1500788..1501573 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T294733 WP_000897305.1 NZ_OU342919:c1496603-1496292 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|