Detailed information of TA system TA294723

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 49248..49674
• Replicon: plasmid p4
• Accession: NZ_OU342710
• Organism: Klebsiella pneumoniae strain Kp1 isolate Kp1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: KXF33_RS28635
• Protein ID: WP_001372321.1
• Coordinates: 49248..49373 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	49450..49674 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KXF33_RS28600 (44299)	44299..44526	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
KXF33_RS28605 (44620)	44620..45306	-	687	WP_045146957.1	PAS domain-containing protein	-
KXF33_RS28610 (45500)	45500..45883	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
KXF33_RS28615 (46169)	46169..46816	+	648	WP_139293854.1	transglycosylase SLT domain-containing protein	-
KXF33_RS28620 (47113)	47113..47934	-	822	WP_001234469.1	DUF932 domain-containing protein	-
KXF33_RS28625 (48053)	48053..48340	-	288	WP_000107542.1	hypothetical protein	-
KXF33_RS28630 (48365)	48365..48571	-	207	WP_032192990.1	hypothetical protein	-
KXF33_RS29090 (48641)	48641..48778	+	138	Protein_54	hypothetical protein	-
KXF33_RS29095 (48798)	48798..49028	-	231	WP_071998556.1	hypothetical protein	-
KXF33_RS28635 (49248)	49248..49373	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
KXF33_RS29100 (49315)	49315..49464	-	150	Protein_57	plasmid maintenance protein Mok	-
- (49450)	49450..49674	-	225	NuclAT_0	-	Antitoxin
- (49450)	49450..49674	-	225	NuclAT_0	-	Antitoxin
- (49450)	49450..49674	-	225	NuclAT_0	-	Antitoxin
- (49450)	49450..49674	-	225	NuclAT_0	-	Antitoxin
KXF33_RS28640 (49685)	49685..50404	-	720	WP_218065132.1	plasmid SOS inhibition protein A	-
KXF33_RS28645 (50401)	50401..50835	-	435	WP_064770609.1	conjugation system SOS inhibitor PsiB	-
KXF33_RS28650 (50890)	50890..52848	-	1959	WP_218065133.1	ParB/RepB/Spo0J family partition protein	-
KXF33_RS28655 (52913)	52913..53146	-	234	WP_000006030.1	DUF905 family protein	-
KXF33_RS28660 (53208)	53208..53747	-	540	WP_009426937.1	single-stranded DNA-binding protein	-
KXF33_RS28665 (53773)	53773..53979	-	207	WP_000547971.1	hypothetical protein	-
KXF33_RS29105 (54220)	54220..54453	-	234	WP_071588969.1	hypothetical protein	-
KXF33_RS29110 (54390)	54390..54608	-	219	WP_071588970.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	-	1..80027	80027

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T294723 WP_001372321.1 NZ_OU342710:c49373-49248 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT294723 NZ_OU342710:c49674-49450 [Klebsiella pneumoniae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTCTTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin