Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 34410..34996 Replicon chromosome
Accession NZ_OU342706
Organism Klebsiella pneumoniae strain Kp1 isolate Kp1

Toxin (Protein)


Gene name doc Uniprot ID A0A483YV82
Locus tag KXF33_RS00170 Protein ID WP_019725145.1
Coordinates 34628..34996 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag KXF33_RS00165 Protein ID WP_019725146.1
Coordinates 34410..34631 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KXF33_RS00145 (KP1VIM_00029) 30567..31493 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
KXF33_RS00150 (KP1VIM_00030) 31490..32767 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
KXF33_RS00155 (KP1VIM_00031) 32764..33531 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
KXF33_RS00160 (KP1VIM_00032) 33533..34246 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
KXF33_RS00165 (KP1VIM_00033) 34410..34631 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KXF33_RS00170 (KP1VIM_00034) 34628..34996 + 369 WP_019725145.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
KXF33_RS00175 (KP1VIM_00035) 35268..36584 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
KXF33_RS00180 (KP1VIM_00036) 36691..37578 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
KXF33_RS00185 (KP1VIM_00037) 37575..38420 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
KXF33_RS00190 (KP1VIM_00038) 38422..39492 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 31490..40229 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T294708 WP_019725145.1 NZ_OU342706:34628-34996 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT294708 WP_019725146.1 NZ_OU342706:34410-34631 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483YV82

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References