Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 189181..189716 Replicon plasmid pl1
Accession NZ_OU016037
Organism Enterococcus faecium isolate USZ_VRE53_P46

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag KKQ98_RS15015 Protein ID WP_002314366.1
Coordinates 189181..189453 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag KKQ98_RS15020 Protein ID WP_002297422.1
Coordinates 189453..189716 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKQ98_RS14975 184429..185109 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
KKQ98_RS14980 185321..185506 - 186 Protein_192 type I restriction endonuclease subunit S -
KKQ98_RS14985 185562..186242 - 681 WP_213313538.1 IS6-like element ISS1N family transposase -
KKQ98_RS14990 186388..186549 - 162 WP_002349958.1 hypothetical protein -
KKQ98_RS14995 186809..187357 - 549 WP_002292681.1 hypothetical protein -
KKQ98_RS15000 187358..188215 - 858 WP_002292680.1 ParA family protein -
KKQ98_RS15005 188499..188785 - 287 Protein_197 type II toxin-antitoxin system RelE/ParE family toxin -
KKQ98_RS15010 188775..189104 - 330 WP_002292678.1 AbrB family transcriptional regulator -
KKQ98_RS15015 189181..189453 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
KKQ98_RS15020 189453..189716 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KKQ98_RS15025 189950..190858 + 909 WP_002295743.1 IS982-like element ISEfm1 family transposase -
KKQ98_RS15030 190861..192036 - 1176 WP_002336205.1 MFS transporter -
KKQ98_RS15035 192039..194288 - 2250 WP_002314387.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(2'')-Ia / aac(6')-aph(2'') - 1..204460 204460
- inside IScluster/Tn - - 176864..202208 25344


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T294705 WP_002314366.1 NZ_OU016037:c189453-189181 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT294705 WP_002297422.1 NZ_OU016037:c189716-189453 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References