Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 187411..187946 Replicon plasmid pl1
Accession NZ_OU016028
Organism Enterococcus faecium isolate USZ_VRE67_P60

Toxin (Protein)


Gene name yoeB Uniprot ID R2PQC0
Locus tag KKQ96_RS14995 Protein ID WP_002314366.1
Coordinates 187411..187683 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q3Y220
Locus tag KKQ96_RS15000 Protein ID WP_002297422.1
Coordinates 187683..187946 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKQ96_RS14955 182659..183339 + 681 WP_001015311.1 IS6-like element IS1216 family transposase -
KKQ96_RS14960 183551..183736 - 186 Protein_190 type I restriction endonuclease subunit S -
KKQ96_RS14965 183792..184472 - 681 WP_213313538.1 IS6-like element ISS1N family transposase -
KKQ96_RS14970 184618..184779 - 162 WP_002349958.1 hypothetical protein -
KKQ96_RS14975 185039..185587 - 549 WP_002292681.1 hypothetical protein -
KKQ96_RS14980 185588..186445 - 858 WP_002292680.1 ParA family protein -
KKQ96_RS14985 186729..187015 - 287 Protein_195 type II toxin-antitoxin system RelE/ParE family toxin -
KKQ96_RS14990 187005..187334 - 330 WP_002292678.1 AbrB family transcriptional regulator -
KKQ96_RS14995 187411..187683 - 273 WP_002314366.1 Txe/YoeB family addiction module toxin Toxin
KKQ96_RS15000 187683..187946 - 264 WP_002297422.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KKQ96_RS15005 188180..189088 + 909 Protein_199 IS982-like element ISEfm1 family transposase -
KKQ96_RS15010 189091..190266 - 1176 WP_002336205.1 MFS transporter -
KKQ96_RS15015 190269..192518 - 2250 WP_002314387.1 alpha-galactosidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') - 1..202690 202690
- inside IScluster/Tn - - 175094..200438 25344


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10780.24 Da        Isoelectric Point: 9.9724

>T294700 WP_002314366.1 NZ_OU016028:c187683-187411 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTHEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9959.22 Da        Isoelectric Point: 4.5370

>AT294700 WP_002297422.1 NZ_OU016028:c187946-187683 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDWKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829F704

Antitoxin

Source ID Structure
AlphaFold DB A0A829F006

References