Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 139597..140132 Replicon plasmid P01
Accession NZ_OU015351
Organism Enterococcus faecium strain AUS2002 isolate AUS2002

Toxin (Protein)


Gene name yoeB Uniprot ID Q3Y221
Locus tag K3T69_RS15295 Protein ID WP_002305108.1
Coordinates 139597..139869 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A133CED7
Locus tag K3T69_RS15300 Protein ID WP_002303154.1
Coordinates 139869..140132 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3T69_RS15265 134604..135791 - 1188 WP_002303156.1 NADP-dependent malic enzyme -
K3T69_RS15270 135979..136926 + 948 WP_002303155.1 sugar-binding domain-containing protein -
K3T69_RS15275 137223..137771 - 549 WP_002292681.1 hypothetical protein -
K3T69_RS15280 137772..138629 - 858 WP_002292680.1 ParA family protein -
K3T69_RS15285 138914..139201 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
K3T69_RS15290 139191..139520 - 330 WP_002292678.1 AbrB family transcriptional regulator -
K3T69_RS15295 139597..139869 - 273 WP_002305108.1 Txe/YoeB family addiction module toxin Toxin
K3T69_RS15300 139869..140132 - 264 WP_002303154.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K3T69_RS15305 140238..140561 - 324 WP_224453712.1 hypothetical protein -
K3T69_RS15310 140660..141340 - 681 WP_010729614.1 IS6-like element ISS1N family transposase -
K3T69_RS15315 141880..143070 - 1191 WP_002314359.1 IS256 family transposase -
K3T69_RS15320 143811..144170 + 360 WP_002303333.1 iron-sulfur cluster biosynthesis family protein -
K3T69_RS15325 144243..145061 - 819 WP_002303335.1 Cof-type HAD-IIB family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') / aph(2'')-Ia - 1..156551 156551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10806.28 Da        Isoelectric Point: 9.9080

>T294681 WP_002305108.1 NZ_OU015351:c139869-139597 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTYEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9886.16 Da        Isoelectric Point: 4.5370

>AT294681 WP_002303154.1 NZ_OU015351:c140132-139869 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDLKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A133CER3

Antitoxin

Source ID Structure
AlphaFold DB A0A133CED7

References