Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 139610..140145 Replicon plasmid P01
Accession NZ_OU015346
Organism Enterococcus faecium strain AUS2001 isolate AUS2001

Toxin (Protein)


Gene name yoeB Uniprot ID Q3Y221
Locus tag K3836_RS14435 Protein ID WP_002305108.1
Coordinates 139610..139882 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A133CED7
Locus tag K3836_RS14440 Protein ID WP_002303154.1
Coordinates 139882..140145 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K3836_RS14405 134616..135803 - 1188 WP_002303156.1 NADP-dependent malic enzyme -
K3836_RS14410 135991..136938 + 948 WP_002303155.1 sugar-binding domain-containing protein -
K3836_RS14415 137235..137783 - 549 WP_002292681.1 hypothetical protein -
K3836_RS14420 137784..138641 - 858 WP_002292680.1 ParA family protein -
K3836_RS14425 138927..139214 - 288 WP_002300557.1 type II toxin-antitoxin system RelE/ParE family toxin -
K3836_RS14430 139204..139533 - 330 WP_002292678.1 AbrB family transcriptional regulator -
K3836_RS14435 139610..139882 - 273 WP_002305108.1 Txe/YoeB family addiction module toxin Toxin
K3836_RS14440 139882..140145 - 264 WP_002303154.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
K3836_RS14445 140251..140667 - 417 WP_002303153.1 hypothetical protein -
K3836_RS14450 140673..141353 - 681 WP_010729614.1 IS6-like element ISS1N family transposase -
K3836_RS14455 141894..143084 - 1191 WP_002314359.1 IS256 family transposase -
K3836_RS14460 143825..144184 + 360 WP_002303333.1 iron-sulfur cluster biosynthesis family protein -
K3836_RS14465 144257..145075 - 819 WP_002303335.1 Cof-type HAD-IIB family hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-aph(2'') / aph(2'')-Ia - 1..156565 156565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(5-69)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10806.28 Da        Isoelectric Point: 9.9080

>T294675 WP_002305108.1 NZ_OU015346:c139882-139610 [Enterococcus faecium]
MNNYSVMIKNSAKADLKKIKQSNLKPQFEKVIQTLKEDPYLPTQSFEKLKPTYEGRYSRRLNRQHRVVYKVDEDEHVVEI
YSARTHYESQ

Download         Length: 273 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9886.16 Da        Isoelectric Point: 4.5370

>AT294675 WP_002303154.1 NZ_OU015346:c140145-139882 [Enterococcus faecium]
MAKTVLNPSSARKNFYKLLKDVNENHTEIEIISERSENNAVLIGLDDLKAIKETLLLEQIGTLGVVRKREKDDSGFTNVD
EIDWDNL

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A133CER3

Antitoxin

Source ID Structure
AlphaFold DB A0A133CED7

References