Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2468458..2468980 | Replicon | chromosome |
Accession | NZ_OU015342 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00007171 isolate AUSMDU00007171 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | KKQ83_RS12100 | Protein ID | WP_000221343.1 |
Coordinates | 2468696..2468980 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | KKQ83_RS12095 | Protein ID | WP_000885424.1 |
Coordinates | 2468458..2468706 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ83_RS12070 (2463674) | 2463674..2465140 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
KKQ83_RS12075 (2465948) | 2465948..2466662 | + | 715 | Protein_2378 | helix-turn-helix domain-containing protein | - |
KKQ83_RS12080 (2466718) | 2466718..2467626 | - | 909 | WP_010989018.1 | hypothetical protein | - |
KKQ83_RS12085 (2467769) | 2467769..2468101 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
KKQ83_RS12090 (2468091) | 2468091..2468306 | - | 216 | WP_000206207.1 | hypothetical protein | - |
KKQ83_RS12095 (2468458) | 2468458..2468706 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
KKQ83_RS12100 (2468696) | 2468696..2468980 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KKQ83_RS12105 (2469151) | 2469151..2469540 | + | 390 | WP_000194089.1 | RidA family protein | - |
KKQ83_RS12110 (2469592) | 2469592..2470671 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
KKQ83_RS12115 (2470864) | 2470864..2471352 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
KKQ83_RS12120 (2471397) | 2471397..2472905 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2463677..2475762 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T294664 WP_000221343.1 NZ_OU015342:2468696-2468980 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |