Detailed information of TA system TA294630

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78326..78752
• Replicon: plasmid P01
• Accession: NZ_OU015324
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: KKQ99_RS26090
• Protein ID: WP_001372321.1
• Coordinates: 78627..78752 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	78326..78550 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KKQ99_RS26055 (74123)	74123..74503	+	381	WP_039026395.1	diacylglycerol kinase	-
KKQ99_RS26060 (74698)	74698..75012	+	315	WP_039026396.1	transposase	-
KKQ99_RS26065 (75048)	75048..75830	+	783	WP_223936907.1	IS3 family transposase	-
KKQ99_RS26070 (75921)	75921..76574	+	654	Protein_101	Tn3 family transposase	-
KKQ99_RS26075 (76634)	76634..77182	+	549	Protein_102	IS6-like element IS26 family transposase	-
KKQ99_RS26080 (77251)	77251..77955	+	705	WP_001067858.1	IS6-like element IS26 family transposase	-
KKQ99_RS26085 (78015)	78015..78314	+	300	Protein_104	plasmid SOS inhibition protein A	-
- (78483)	78483..78548	+	66	NuclAT_1	-	-
- (78326)	78326..78550	+	225	NuclAT_0	-	Antitoxin
- (78326)	78326..78550	+	225	NuclAT_0	-	Antitoxin
- (78326)	78326..78550	+	225	NuclAT_0	-	Antitoxin
- (78326)	78326..78550	+	225	NuclAT_0	-	Antitoxin
- (78326)	78326..78550	-	225	NuclAT_0	-	-
KKQ99_RS26600 (78536)	78536..78685	+	150	Protein_105	plasmid maintenance protein Mok	-
KKQ99_RS26090 (78627)	78627..78752	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
KKQ99_RS26095 (79073)	79073..79777	-	705	WP_001067858.1	IS6-like element IS26 family transposase	-
KKQ99_RS26100 (79849)	79849..80817	+	969	Protein_108	Tn3 family transposase	-
KKQ99_RS26105 (80852)	80852..81525	-	674	Protein_109	IS1-like element IS1B family transposase	-
KKQ99_RS26110 (81782)	81782..82054	-	273	Protein_110	IS1 family transposase	-
KKQ99_RS26115 (82148)	82148..83581	+	1434	WP_001288435.1	DNA cytosine methyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / qnrS1 / catA2 / blaCTX-M-55 / mcr-3.1 / blaTEM-1B	-	1..123084	123084
	-	inside	IScluster/Tn	catA2 / blaCTX-M-55 / mcr-3.1 / blaTEM-1B	-	65098..92625	27527

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T294630 WP_001372321.1 NZ_OU015324:78627-78752 [Salmonella enterica subsp. enterica serovar Typhimurium]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT294630 NZ_OU015324:78326-78550 [Salmonella enterica subsp. enterica serovar Typhimurium]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin