Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 3618166..3618704 | Replicon | chromosome |
Accession | NZ_OU015323 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | KKQ99_RS18235 | Protein ID | WP_001526148.1 |
Coordinates | 3618429..3618704 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | M7RMV7 |
Locus tag | KKQ99_RS18230 | Protein ID | WP_000729713.1 |
Coordinates | 3618166..3618426 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ99_RS18205 (3613574) | 3613574..3613726 | + | 153 | WP_001541028.1 | hypothetical protein | - |
KKQ99_RS18210 (3613719) | 3613719..3615272 | + | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
KKQ99_RS18215 (3615281) | 3615281..3615472 | + | 192 | Protein_3574 | TROVE domain-containing protein | - |
KKQ99_RS18220 (3615820) | 3615820..3617034 | + | 1215 | WP_001105521.1 | RNA-splicing ligase RtcB | - |
KKQ99_RS18225 (3617038) | 3617038..3618057 | + | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
KKQ99_RS18230 (3618166) | 3618166..3618426 | + | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
KKQ99_RS18235 (3618429) | 3618429..3618704 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
KKQ99_RS18240 (3618792) | 3618792..3621497 | - | 2706 | WP_000907029.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T294625 WP_001526148.1 NZ_OU015323:3618429-3618704 [Salmonella enterica subsp. enterica serovar Typhimurium]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Download Length: 87 a.a. Molecular weight: 9446.80 Da Isoelectric Point: 4.4734
>AT294625 WP_000729713.1 NZ_OU015323:3618166-3618426 [Salmonella enterica subsp. enterica serovar Typhimurium]
MAANALVRARIDETLKDQAADVLAEMGLTISDLIRITLTKVAREKALPFDLRIPNELTSRTIENSEAGVDIHKAKDADDL
FDQLGI
MAANALVRARIDETLKDQAADVLAEMGLTISDLIRITLTKVAREKALPFDLRIPNELTSRTIENSEAGVDIHKAKDADDL
FDQLGI
Download Length: 261 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D6P2L2 |