Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3050903..3051657 | Replicon | chromosome |
| Accession | NZ_OU015323 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | KKQ99_RS15540 | Protein ID | WP_000558166.1 |
| Coordinates | 3050903..3051214 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | KKQ99_RS15545 | Protein ID | WP_001259011.1 |
| Coordinates | 3051211..3051657 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KKQ99_RS15510 (3046561) | 3046561..3047463 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| KKQ99_RS15515 (3047460) | 3047460..3048095 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| KKQ99_RS15520 (3048092) | 3048092..3049021 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| KKQ99_RS15525 (3049068) | 3049068..3049358 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| KKQ99_RS15530 (3049359) | 3049359..3049670 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| KKQ99_RS15535 (3049888) | 3049888..3050817 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| KKQ99_RS15540 (3050903) | 3050903..3051214 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| KKQ99_RS15545 (3051211) | 3051211..3051657 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| KKQ99_RS15550 (3051672) | 3051672..3052613 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| KKQ99_RS15555 (3052658) | 3052658..3053095 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| KKQ99_RS15560 (3053092) | 3053092..3053964 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| KKQ99_RS15565 (3053958) | 3053958..3054557 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| KKQ99_RS15570 (3054748) | 3054748..3055551 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| KKQ99_RS15575 (3055585) | 3055585..3056481 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T294622 WP_000558166.1 NZ_OU015323:3050903-3051214 [Salmonella enterica subsp. enterica serovar Typhimurium]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT294622 WP_001259011.1 NZ_OU015323:3051211-3051657 [Salmonella enterica subsp. enterica serovar Typhimurium]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|