Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3049068..3049670 | Replicon | chromosome |
Accession | NZ_OU015323 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | KKQ99_RS15530 | Protein ID | WP_001159630.1 |
Coordinates | 3049359..3049670 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KKQ99_RS15525 | Protein ID | WP_000362050.1 |
Coordinates | 3049068..3049358 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKQ99_RS15510 (3046561) | 3046561..3047463 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
KKQ99_RS15515 (3047460) | 3047460..3048095 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
KKQ99_RS15520 (3048092) | 3048092..3049021 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
KKQ99_RS15525 (3049068) | 3049068..3049358 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
KKQ99_RS15530 (3049359) | 3049359..3049670 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
KKQ99_RS15535 (3049888) | 3049888..3050817 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
KKQ99_RS15540 (3050903) | 3050903..3051214 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
KKQ99_RS15545 (3051211) | 3051211..3051657 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
KKQ99_RS15550 (3051672) | 3051672..3052613 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
KKQ99_RS15555 (3052658) | 3052658..3053095 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
KKQ99_RS15560 (3053092) | 3053092..3053964 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
KKQ99_RS15565 (3053958) | 3053958..3054557 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T294621 WP_001159630.1 NZ_OU015323:c3049670-3049359 [Salmonella enterica subsp. enterica serovar Typhimurium]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT294621 WP_000362050.1 NZ_OU015323:c3049358-3049068 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|