Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) stbDE/ParE-YafN
Location 680238..680760 Replicon chromosome
Accession NZ_OU015323
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00004549 isolate AUSMDU00004549

Toxin (Protein)


Gene name stbE Uniprot ID B5F5Y5
Locus tag KKQ99_RS03630 Protein ID WP_000221343.1
Coordinates 680476..680760 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name stbD Uniprot ID V1H457
Locus tag KKQ99_RS03625 Protein ID WP_000885424.1
Coordinates 680238..680486 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KKQ99_RS03595 (676019) 676019..676762 - 744 WP_229038580.1 IS3 family transposase -
KKQ99_RS03600 (676837) 676837..677151 - 315 WP_039026396.1 transposase -
KKQ99_RS03605 (677728) 677728..678442 + 715 Protein_716 helix-turn-helix domain-containing protein -
KKQ99_RS03610 (678498) 678498..679406 - 909 WP_010989018.1 hypothetical protein -
KKQ99_RS03615 (679549) 679549..679881 - 333 WP_000253154.1 DUF1493 family protein -
KKQ99_RS03620 (679871) 679871..680086 - 216 WP_000206207.1 hypothetical protein -
KKQ99_RS03625 (680238) 680238..680486 + 249 WP_000885424.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KKQ99_RS03630 (680476) 680476..680760 + 285 WP_000221343.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KKQ99_RS03635 (680931) 680931..681062 + 132 Protein_722 RidA family protein -
KKQ99_RS03640 (681115) 681115..681429 + 315 WP_039026396.1 transposase -
KKQ99_RS03645 (681504) 681504..682247 + 744 WP_229038580.1 IS3 family transposase -
KKQ99_RS03650 (682277) 682277..682537 + 261 Protein_725 RidA family protein -
KKQ99_RS03655 (682589) 682589..683668 - 1080 WP_000954688.1 S-adenosylmethionine:tRNA ribosyltransferase-isomerase -
KKQ99_RS03660 (683861) 683861..684349 - 489 WP_001293638.1 MarR family winged helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Genomic island - - 674240..688759 14519
- inside IScluster/Tn - - 676019..682247 6228


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11075.85 Da        Isoelectric Point: 10.6500

>T294614 WP_000221343.1 NZ_OU015323:680476-680760 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS

Download         Length: 285 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9090.32 Da        Isoelectric Point: 3.9820

>AT294614 WP_000885424.1 NZ_OU015323:680238-680486 [Salmonella enterica subsp. enterica serovar Typhimurium]
MAFQILTTTAASITELKRDPMGTFNAGDGAPVAILNRNEPAFYCVPPALYAHLMDILEDEELGRIIDERANERVIEVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5H5JSW4

Antitoxin

Source ID Structure
AlphaFold DB A0A5I0WPN5

References