Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2718266..2718602 | Replicon | chromosome |
Accession | NZ_OD940440 | ||
Organism | Enterococcus faecalis isolate WE0254 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | KG893_RS13445 | Protein ID | WP_002381035.1 |
Coordinates | 2718266..2718409 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2718553..2718602 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KG893_RS13425 | 2714370..2714999 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
KG893_RS13430 | 2715692..2717308 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
KG893_RS13435 | 2717638..2717781 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
KG893_RS13440 | 2717900..2718040 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
KG893_RS13445 | 2718266..2718409 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- | 2718553..2718602 | + | 50 | - | - | Antitoxin |
KG893_RS13450 | 2718604..2723295 | - | 4692 | WP_010783624.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T294608 WP_002381035.1 NZ_OD940440:2718266-2718409 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT294608 NZ_OD940440:2718553-2718602 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|