Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2631902..2632365 | Replicon | chromosome |
Accession | NZ_OD940440 | ||
Organism | Enterococcus faecalis isolate WE0254 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | KG893_RS13050 | Protein ID | WP_002392696.1 |
Coordinates | 2631902..2632045 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2632221..2632365 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KG893_RS13035 | 2627148..2627861 | - | 714 | WP_002381063.1 | trehalose operon repressor | - |
KG893_RS13040 | 2628123..2630867 | + | 2745 | WP_002398920.1 | glycosyl hydrolase family 65 protein | - |
KG893_RS13045 | 2630882..2631532 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
KG893_RS13050 | 2631902..2632045 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 2632221..2632365 | + | 145 | - | - | Antitoxin |
KG893_RS14920 | 2632453..2632578 | - | 126 | WP_002398921.1 | hypothetical protein | - |
KG893_RS14925 | 2633119..2633394 | + | 276 | WP_224805966.1 | CPBP family intramembrane metalloprotease | - |
KG893_RS13060 | 2633448..2634419 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
KG893_RS13065 | 2634594..2635031 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
KG893_RS13070 | 2635164..2635718 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T294593 WP_002392696.1 NZ_OD940440:c2632045-2631902 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT294593 NZ_OD940440:2632221-2632365 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|