Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 66483..66697 | Replicon | plasmid contig000002 |
| Accession | NZ_OD940438 | ||
| Organism | Enterococcus faecalis isolate BX8117 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | KJA90_RS14345 | Protein ID | WP_002360667.1 |
| Coordinates | 66483..66593 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 66633..66697 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA90_RS14305 | 61668..61874 | + | 207 | Protein_67 | transposase | - |
| KJA90_RS14310 | 62404..63024 | + | 621 | WP_021732893.1 | recombinase family protein | - |
| KJA90_RS14315 | 63041..63328 | + | 288 | WP_010708491.1 | hypothetical protein | - |
| KJA90_RS14320 | 63322..63546 | + | 225 | WP_010708492.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| KJA90_RS14325 | 63607..63816 | + | 210 | WP_002387638.1 | hypothetical protein | - |
| KJA90_RS14760 | 63978..64130 | + | 153 | WP_225850000.1 | DUF6440 family protein | - |
| KJA90_RS14335 | 64557..65885 | + | 1329 | WP_021732894.1 | ultraviolet resistance protein UvrA | - |
| KJA90_RS14340 | 65882..66232 | + | 351 | WP_002399364.1 | hypothetical protein | - |
| KJA90_RS14765 | 66189..66401 | + | 213 | WP_002360669.1 | hypothetical protein | - |
| KJA90_RS14345 | 66483..66593 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 66633..66697 | - | 65 | - | - | Antitoxin |
| KJA90_RS14350 | 66833..67129 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
| KJA90_RS14355 | 67383..68165 | + | 783 | WP_002360664.1 | ParA family protein | - |
| KJA90_RS14360 | 68158..68514 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | prgB/asc10 | 1..68773 | 68773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T294581 WP_002360667.1 NZ_OD940438:66483-66593 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT294581 NZ_OD940438:c66697-66633 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|