Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2808642..2808978 | Replicon | chromosome |
| Accession | NZ_OD940437 | ||
| Organism | Enterococcus faecalis isolate BX8117 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | KJA90_RS13545 | Protein ID | WP_002396786.1 |
| Coordinates | 2808642..2808785 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2808929..2808978 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA90_RS13525 | 2803858..2804073 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| KJA90_RS13530 | 2804212..2805204 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| KJA90_RS13535 | 2805371..2806009 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| KJA90_RS13540 | 2806694..2808310 | + | 1617 | WP_002378864.1 | phosphatase PAP2/LCP family protein | - |
| KJA90_RS13545 | 2808642..2808785 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - | 2808929..2808978 | + | 50 | - | - | Antitoxin |
| KJA90_RS13550 | 2808980..2813671 | - | 4692 | WP_002378865.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T294579 WP_002396786.1 NZ_OD940437:2808642-2808785 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT294579 NZ_OD940437:2808929-2808978 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|