Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2697149..2697487 | Replicon | chromosome |
| Accession | NZ_OD940434 | ||
| Organism | Enterococcus faecalis isolate BX5936 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | KJA96_RS12980 | Protein ID | WP_078130893.1 |
| Coordinates | 2697149..2697298 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2697438..2697487 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA96_RS12965 | 2692805..2693437 | - | 633 | WP_002358972.1 | RloB family protein | - |
| KJA96_RS12970 | 2693446..2694741 | - | 1296 | WP_010820355.1 | ATP-binding protein | - |
| KJA96_RS12975 | 2695203..2696819 | + | 1617 | WP_078130894.1 | phosphatase PAP2/LCP family protein | - |
| KJA96_RS12980 | 2697149..2697298 | + | 150 | WP_078130893.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 2697438..2697487 | + | 50 | - | - | Antitoxin |
| KJA96_RS14215 | 2697489..2702176 | - | 4688 | Protein_2543 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5766.10 Da Isoelectric Point: 11.3858
>T294566 WP_078130893.1 NZ_OD940434:2697149-2697298 [Enterococcus faecalis]
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIVLIVKLLKNDKKK
MRMHVFPKFRERRGLLSAYETIQTILGFGMFTIALIVLIVKLLKNDKKK
Download Length: 150 bp
Antitoxin
Download Length: 50 bp
>AT294566 NZ_OD940434:2697438-2697487 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|