Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
Location | 49482..49723 | Replicon | plasmid contig000003 |
Accession | NZ_OD940433 | ||
Organism | Enterococcus faecalis isolate TM6294 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | KJA93_RS14065 | Protein ID | WP_002360667.1 |
Coordinates | 49482..49592 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 49632..49723 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA93_RS14030 (45427) | 45427..46107 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
KJA93_RS14035 (46279) | 46279..46899 | + | 621 | WP_013438829.1 | recombinase family protein | - |
KJA93_RS14040 (46916) | 46916..47200 | + | 285 | WP_002394798.1 | hypothetical protein | - |
KJA93_RS14045 (47202) | 47202..47435 | + | 234 | WP_002394799.1 | hypothetical protein | - |
KJA93_RS14050 (47595) | 47595..47849 | - | 255 | WP_002394800.1 | hypothetical protein | - |
KJA93_RS14055 (47966) | 47966..48634 | - | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
KJA93_RS14060 (48670) | 48670..48987 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
KJA93_RS14065 (49482) | 49482..49592 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (49632) | 49632..49723 | - | 92 | NuclAT_0 | - | Antitoxin |
- (49632) | 49632..49723 | - | 92 | NuclAT_0 | - | Antitoxin |
- (49632) | 49632..49723 | - | 92 | NuclAT_0 | - | Antitoxin |
- (49632) | 49632..49723 | - | 92 | NuclAT_0 | - | Antitoxin |
KJA93_RS14070 (49832) | 49832..50131 | + | 300 | WP_033598519.1 | hypothetical protein | - |
KJA93_RS14075 (50711) | 50711..51253 | - | 543 | WP_086321354.1 | hypothetical protein | - |
KJA93_RS14080 (51263) | 51263..52114 | - | 852 | WP_002362419.1 | ParA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | fexA / optrA | prgB/asc10 | 1..52776 | 52776 | |
- | flank | IS/Tn | fexA / optrA | - | 41123..46107 | 4984 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T294553 WP_002360667.1 NZ_OD940433:49482-49592 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT294553 NZ_OD940433:c49723-49632 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|