Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2706781..2707184 | Replicon | chromosome |
Accession | NZ_OD940431 | ||
Organism | Enterococcus faecalis isolate TM6294 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6I4Y3R3 |
Locus tag | KJA93_RS12910 | Protein ID | WP_033624079.1 |
Coordinates | 2707041..2707184 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2706781..2706868 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA93_RS12890 | 2702254..2702469 | - | 216 | WP_213044572.1 | zinc ribbon domain-containing protein | - |
KJA93_RS12895 | 2702608..2703600 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
KJA93_RS12900 | 2703767..2704405 | - | 639 | WP_126254829.1 | lytic polysaccharide monooxygenase | - |
KJA93_RS12905 | 2705092..2706708 | + | 1617 | WP_126254830.1 | phosphatase PAP2/LCP family protein | - |
- | 2706781..2706868 | - | 88 | - | - | Antitoxin |
KJA93_RS12910 | 2707041..2707184 | + | 144 | WP_033624079.1 | putative holin-like toxin | Toxin |
KJA93_RS12915 | 2707378..2710437 | - | 3060 | WP_161970875.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5186.29 Da Isoelectric Point: 10.5719
>T294542 WP_033624079.1 NZ_OD940431:2707041-2707184 [Enterococcus faecalis]
MNVSAKIYERRGLLSIAEALALMISFGSFIATLIFGILKAVKEDKKK
MNVSAKIYERRGLLSIAEALALMISFGSFIATLIFGILKAVKEDKKK
Download Length: 144 bp
Antitoxin
Download Length: 88 bp
>AT294542 NZ_OD940431:c2706868-2706781 [Enterococcus faecalis]
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTGATGTAGAGCCGTTACTAACGGTGACAAAA
TTTTTACA
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTGTAACATACCTCTCTGATGTAGAGCCGTTACTAACGGTGACAAAA
TTTTTACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|