Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2601485..2601747 | Replicon | chromosome |
| Accession | NZ_OD940431 | ||
| Organism | Enterococcus faecalis isolate TM6294 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | KJA93_RS12435 | Protein ID | WP_002392696.1 |
| Coordinates | 2601604..2601747 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2601485..2601630 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA93_RS12420 | 2596850..2597563 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| KJA93_RS12420 | 2596850..2597563 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| KJA93_RS12425 | 2597825..2600569 | + | 2745 | WP_126254803.1 | glycosyl hydrolase family 65 protein | - |
| KJA93_RS12425 | 2597825..2600569 | + | 2745 | WP_126254803.1 | glycosyl hydrolase family 65 protein | - |
| KJA93_RS12430 | 2600584..2601234 | + | 651 | WP_010824266.1 | beta-phosphoglucomutase | - |
| KJA93_RS12430 | 2600584..2601234 | + | 651 | WP_010824266.1 | beta-phosphoglucomutase | - |
| - | 2601303..2601438 | + | 136 | - | - | - |
| - | 2601485..2601630 | + | 146 | - | - | Antitoxin |
| KJA93_RS12435 | 2601604..2601747 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KJA93_RS12435 | 2601604..2601747 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| KJA93_RS12440 | 2601979..2602950 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| KJA93_RS12440 | 2601979..2602950 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| KJA93_RS12445 | 2603125..2603562 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| KJA93_RS12445 | 2603125..2603562 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| KJA93_RS12450 | 2603695..2604249 | - | 555 | WP_002354869.1 | Maf family protein | - |
| KJA93_RS12450 | 2603695..2604249 | - | 555 | WP_002354869.1 | Maf family protein | - |
| KJA93_RS12455 | 2604274..2606406 | - | 2133 | WP_126254804.1 | DNA mismatch repair endonuclease MutL | - |
| KJA93_RS12455 | 2604274..2606406 | - | 2133 | WP_126254804.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T294539 WP_002392696.1 NZ_OD940431:c2601747-2601604 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT294539 NZ_OD940431:2601485-2601630 [Enterococcus faecalis]
TGTGCTATAATGAAAATGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAATGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|