Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 313123..313318 | Replicon | chromosome |
Accession | NZ_OD940431 | ||
Organism | Enterococcus faecalis isolate TM6294 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | KJA93_RS01580 | Protein ID | WP_015543884.1 |
Coordinates | 313223..313318 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 313123..313188 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA93_RS01565 | 308754..310496 | + | 1743 | WP_213044574.1 | PTS transporter subunit EIIC | - |
KJA93_RS01570 | 310487..312520 | + | 2034 | WP_002370205.1 | PRD domain-containing protein | - |
KJA93_RS01575 | 312531..312965 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 313123..313188 | + | 66 | - | - | Antitoxin |
KJA93_RS01580 | 313223..313318 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
KJA93_RS01585 | 313564..315336 | + | 1773 | WP_010717458.1 | PTS mannitol-specific transporter subunit IIBC | - |
KJA93_RS01590 | 315351..315788 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
KJA93_RS01595 | 315803..316957 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
KJA93_RS01600 | 317024..318139 | - | 1116 | WP_002361174.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T294531 WP_015543884.1 NZ_OD940431:c313318-313223 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT294531 NZ_OD940431:313123-313188 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|