Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 1172301..1172636 | Replicon | chromosome |
Accession | NZ_OD940422 | ||
Organism | Enterococcus faecalis isolate WE0851 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | KJA80_RS05480 | Protein ID | WP_002415596.1 |
Coordinates | 1172301..1172444 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 1172586..1172636 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJA80_RS05460 | 1167418..1167633 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
KJA80_RS05465 | 1167772..1168764 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
KJA80_RS05470 | 1169028..1169666 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
KJA80_RS05475 | 1170353..1171969 | + | 1617 | WP_002415597.1 | phosphatase PAP2/LCP family protein | - |
KJA80_RS05480 | 1172301..1172444 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- | 1172586..1172636 | + | 51 | - | - | Antitoxin |
KJA80_RS05485 | 1172637..1176404 | - | 3768 | WP_010712914.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T294527 WP_002415596.1 NZ_OD940422:1172301-1172444 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT294527 NZ_OD940422:1172586-1172636 [Enterococcus faecalis]
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|