Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-RNAII/- |
| Location | 1100179..1100578 | Replicon | chromosome |
| Accession | NZ_OD940422 | ||
| Organism | Enterococcus faecalis isolate WE0851 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | KJA80_RS05150 | Protein ID | WP_002367458.1 |
| Coordinates | 1100179..1100322 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 1100434..1100578 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA80_RS05135 | 1095471..1096184 | - | 714 | WP_002415630.1 | trehalose operon repressor | - |
| KJA80_RS14000 | 1096287..1096421 | - | 135 | WP_002415629.1 | hypothetical protein | - |
| KJA80_RS05140 | 1096445..1099189 | + | 2745 | WP_002415628.1 | glycosyl hydrolase family 65 protein | - |
| KJA80_RS05145 | 1099204..1099854 | + | 651 | WP_002415627.1 | beta-phosphoglucomutase | - |
| KJA80_RS05150 | 1100179..1100322 | - | 144 | WP_002367458.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 1100434..1100578 | + | 145 | - | - | Antitoxin |
| KJA80_RS14005 | 1100666..1100791 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| KJA80_RS05155 | 1101075..1101608 | + | 534 | WP_002415626.1 | CPBP family intramembrane metalloprotease | - |
| KJA80_RS05160 | 1101662..1102633 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| KJA80_RS05165 | 1102808..1103245 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| KJA80_RS05170 | 1103378..1103932 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5311.50 Da Isoelectric Point: 10.8331
>T294523 WP_002367458.1 NZ_OD940422:c1100322-1100179 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT294523 NZ_OD940422:1100434-1100578 [Enterococcus faecalis]
TTGTGCTATAATAAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATAAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|