Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2873147..2873482 | Replicon | chromosome |
| Accession | NZ_OD940420 | ||
| Organism | Enterococcus faecalis isolate WE0438 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | KJA91_RS13750 | Protein ID | WP_002415596.1 |
| Coordinates | 2873147..2873290 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2873432..2873482 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS13730 (2868264) | 2868264..2868479 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| KJA91_RS13735 (2868618) | 2868618..2869610 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| KJA91_RS13740 (2869874) | 2869874..2870512 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
| KJA91_RS13745 (2871199) | 2871199..2872815 | + | 1617 | WP_002415597.1 | phosphatase PAP2/LCP family protein | - |
| KJA91_RS13750 (2873147) | 2873147..2873290 | + | 144 | WP_002415596.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2873223) | 2873223..2873481 | - | 259 | NuclAT_2 | - | - |
| - (2873432) | 2873432..2873482 | + | 51 | NuclAT_13 | - | Antitoxin |
| KJA91_RS13755 (2873483) | 2873483..2877250 | - | 3768 | WP_010712914.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5314.46 Da Isoelectric Point: 10.6323
>T294513 WP_002415596.1 NZ_OD940420:2873147-2873290 [Enterococcus faecalis]
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MNVSAKIYERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 51 bp
>AT294513 NZ_OD940420:2873432-2873482 [Enterococcus faecalis]
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|