Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2800906..2801168 | Replicon | chromosome |
| Accession | NZ_OD940420 | ||
| Organism | Enterococcus faecalis isolate WE0438 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | KJA91_RS13420 | Protein ID | WP_002367458.1 |
| Coordinates | 2801025..2801168 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2800906..2801092 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS13405 (2796317) | 2796317..2797030 | - | 714 | WP_002415630.1 | trehalose operon repressor | - |
| KJA91_RS14685 (2797133) | 2797133..2797267 | - | 135 | WP_002415629.1 | hypothetical protein | - |
| KJA91_RS13410 (2797291) | 2797291..2800035 | + | 2745 | WP_002415628.1 | glycosyl hydrolase family 65 protein | - |
| KJA91_RS13415 (2800050) | 2800050..2800700 | + | 651 | WP_002415627.1 | beta-phosphoglucomutase | - |
| - (2800769) | 2800769..2800837 | + | 69 | NuclAT_12 | - | - |
| - (2800755) | 2800755..2800839 | + | 85 | NuclAT_5 | - | - |
| - (2800906) | 2800906..2801092 | + | 187 | NuclAT_3 | - | Antitoxin |
| KJA91_RS13420 (2801025) | 2801025..2801168 | - | 144 | WP_002367458.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - (2801269) | 2801269..2801422 | + | 154 | NuclAT_4 | - | - |
| - (2801280) | 2801280..2801424 | + | 145 | NuclAT_11 | - | - |
| KJA91_RS14690 (2801512) | 2801512..2801637 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| KJA91_RS13425 (2801921) | 2801921..2802454 | + | 534 | WP_002415626.1 | CPBP family intramembrane metalloprotease | - |
| KJA91_RS13430 (2802508) | 2802508..2803479 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| KJA91_RS13435 (2803654) | 2803654..2804091 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| KJA91_RS13440 (2804224) | 2804224..2804778 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5311.50 Da Isoelectric Point: 10.8331
>T294506 WP_002367458.1 NZ_OD940420:c2801168-2801025 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 144 bp
Antitoxin
Download Length: 187 bp
>AT294506 NZ_OD940420:2800906-2801092 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCAATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCAATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTCTTGTCATTTTTAAGCAATTTCACAATCAGTG
CAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|