Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 309284..309479 | Replicon | chromosome |
| Accession | NZ_OD940420 | ||
| Organism | Enterococcus faecalis isolate WE0438 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | KJA91_RS01565 | Protein ID | WP_015543884.1 |
| Coordinates | 309384..309479 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 309284..309349 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS01550 (304910) | 304910..306658 | + | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
| KJA91_RS01555 (306649) | 306649..308682 | + | 2034 | WP_002397548.1 | BglG family transcription antiterminator | - |
| KJA91_RS01560 (308693) | 308693..309127 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (309284) | 309284..309349 | + | 66 | NuclAT_14 | - | Antitoxin |
| KJA91_RS01565 (309384) | 309384..309479 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| KJA91_RS01570 (309725) | 309725..311497 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
| KJA91_RS01575 (311512) | 311512..311949 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| KJA91_RS01580 (311964) | 311964..313118 | + | 1155 | WP_213044533.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| KJA91_RS01585 (313187) | 313187..314302 | - | 1116 | WP_002397546.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T294494 WP_015543884.1 NZ_OD940420:c309479-309384 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT294494 NZ_OD940420:309284-309349 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|