Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1995187..1995449 | Replicon | chromosome |
Accession | NZ_LT996891 | ||
Organism | Staphylococcus aureus isolate 24117-WT |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DYY95_RS10120 | Protein ID | WP_001802298.1 |
Coordinates | 1995187..1995291 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 1995286..1995449 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY95_RS10095 | 1991983..1992765 | + | 783 | WP_000908174.1 | ABC transporter ATP-binding protein | - |
DYY95_RS10100 | 1992833..1993690 | + | 858 | WP_000370931.1 | Cof-type HAD-IIB family hydrolase | - |
DYY95_RS10110 | 1994349..1994507 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DYY95_RS10120 | 1995187..1995291 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1995286..1995449 | - | 164 | - | - | Antitoxin |
DYY95_RS10125 | 1996099..1997745 | + | 1647 | WP_000277718.1 | IS1182 family transposase | - |
DYY95_RS10130 | 1997774..1998865 | - | 1092 | WP_000495672.1 | hypothetical protein | - |
DYY95_RS10135 | 1999131..2000111 | - | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
DYY95_RS10140 | 2000113..2000433 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1996099..1997745 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294470 WP_001802298.1 NZ_LT996891:1995187-1995291 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 164 bp
>AT294470 NZ_LT996891:c1995449-1995286 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCAAAGCGAATAGAAGGTT
ATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|