Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1715236..1715420 | Replicon | chromosome |
Accession | NZ_LT996891 | ||
Organism | Staphylococcus aureus isolate 24117-WT |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DYY95_RS08585 | Protein ID | WP_000482647.1 |
Coordinates | 1715236..1715343 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1715360..1715420 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY95_RS08560 | 1710608..1711081 | + | 474 | WP_000456492.1 | GyrI-like domain-containing protein | - |
DYY95_RS08565 | 1711204..1712415 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
DYY95_RS08570 | 1712597..1713256 | - | 660 | WP_000831295.1 | hypothetical protein | - |
DYY95_RS08575 | 1713316..1714458 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
DYY95_RS08580 | 1714716..1715102 | + | 387 | WP_000779360.1 | flippase GtxA | - |
DYY95_RS08585 | 1715236..1715343 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1715360..1715420 | - | 61 | - | - | Antitoxin |
DYY95_RS08595 | 1716047..1717810 | + | 1764 | WP_001064836.1 | ABC transporter ATP-binding protein/permease | - |
DYY95_RS08600 | 1717835..1719568 | + | 1734 | WP_000486496.1 | ABC transporter ATP-binding protein/permease | - |
DYY95_RS08610 | 1719799..1719966 | + | 168 | WP_001792506.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294468 WP_000482647.1 NZ_LT996891:1715236-1715343 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294468 NZ_LT996891:c1715420-1715360 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|