Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1995184..1995462 | Replicon | chromosome |
Accession | NZ_LT996889 | ||
Organism | Staphylococcus aureus isolate 24117-REV |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DYY93_RS10120 | Protein ID | WP_001802298.1 |
Coordinates | 1995184..1995288 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1995284..1995462 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DYY93_RS10095 | 1991980..1992762 | + | 783 | WP_000908174.1 | ABC transporter ATP-binding protein | - |
DYY93_RS10100 | 1992830..1993687 | + | 858 | WP_000370931.1 | Cof-type HAD-IIB family hydrolase | - |
DYY93_RS10110 | 1994346..1994504 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DYY93_RS10120 | 1995184..1995288 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1995284..1995462 | - | 179 | - | - | Antitoxin |
DYY93_RS10125 | 1996096..1997742 | + | 1647 | WP_000277718.1 | IS1182 family transposase | - |
DYY93_RS10130 | 1997771..1998862 | - | 1092 | WP_000495672.1 | hypothetical protein | - |
DYY93_RS10135 | 1999128..2000108 | - | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
DYY93_RS10140 | 2000110..2000430 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1996096..1997742 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294445 WP_001802298.1 NZ_LT996889:1995184-1995288 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 179 bp
>AT294445 NZ_LT996889:c1995462-1995284 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCA
AAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAATGCCGGTCA
AAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|