Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 659582..660171 Replicon chromosome
Accession NZ_LT996886
Organism Tessaracoccus timonensis strain Marseille-P5995

Toxin (Protein)


Gene name graT Uniprot ID -
Locus tag DHT94_RS03220 Protein ID WP_108870573.1
Coordinates 659890..660171 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DHT94_RS03215 Protein ID WP_108870572.1
Coordinates 659582..659881 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DHT94_RS03170 654730..655554 - 825 WP_108870567.1 alpha/beta hydrolase -
DHT94_RS03175 655610..656389 - 780 WP_108870568.1 biotin--protein ligase -
DHT94_RS03180 656569..656805 - 237 WP_108870569.1 hypothetical protein -
DHT94_RS03185 656802..657227 - 426 WP_108870570.1 type II toxin-antitoxin system VapC family toxin -
DHT94_RS03190 657224..657457 - 234 WP_108872311.1 Arc family DNA-binding protein -
DHT94_RS03195 657611..657946 - 336 WP_197709356.1 HigA family addiction module antidote protein -
DHT94_RS03200 657906..658151 - 246 WP_108870571.1 type II toxin-antitoxin system RelE/ParE family toxin -
DHT94_RS03205 658731..659273 + 543 WP_108872313.1 DUF488 domain-containing protein -
DHT94_RS03215 659582..659881 - 300 WP_108870572.1 HigA family addiction module antidote protein Antitoxin
DHT94_RS03220 659890..660171 - 282 WP_108870573.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DHT94_RS03225 660415..660744 - 330 WP_108870574.1 nucleotidyltransferase domain-containing protein -
DHT94_RS03230 660847..661242 - 396 WP_197709357.1 GNAT family N-acetyltransferase -
DHT94_RS03235 661392..661817 - 426 WP_108870575.1 type II toxin-antitoxin system VapC family toxin -
DHT94_RS03240 661814..662047 - 234 WP_108870576.1 Arc family DNA-binding protein -
DHT94_RS03245 662249..662536 - 288 WP_197709358.1 HigA family addiction module antidote protein -
DHT94_RS03250 662496..662755 - 260 Protein_634 type II toxin-antitoxin system RelE/ParE family toxin -
DHT94_RS03260 663170..663814 - 645 WP_197709474.1 hypothetical protein -
DHT94_RS03265 663931..664569 - 639 WP_108870579.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(7-84)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10802.29 Da        Isoelectric Point: 9.2033

>T294436 WP_108870573.1 NZ_LT996886:c660171-659890 [Tessaracoccus timonensis]
VIRSFGDRDTELVWLREPAPRIDPRIHKSANRKLHLLDAAVSLNSLRVPPGNRLEALKGDRRGQHSIRINDQWRICFVWT
EAGPENVIIEDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11184.92 Da        Isoelectric Point: 6.2248

>AT294436 WP_108870572.1 NZ_LT996886:c659881-659582 [Tessaracoccus timonensis]
MTEKLYAPIHPGEVLMEDFIEGFGITQHKLAVSIGVPPRRINEIVHGKRAITADTALRLGRYFGVEPQFWLTLQSRYELE
LAQERVADQVAEIKPLQAA

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References