Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 640413..641074 | Replicon | chromosome |
| Accession | NZ_LT996886 | ||
| Organism | Tessaracoccus timonensis strain Marseille-P5995 | ||
Toxin (Protein)
| Gene name | HigB2 | Uniprot ID | - |
| Locus tag | DHT94_RS03120 | Protein ID | WP_108872309.1 |
| Coordinates | 640724..641074 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | HigA2 | Uniprot ID | - |
| Locus tag | DHT94_RS03115 | Protein ID | WP_108872308.1 |
| Coordinates | 640413..640718 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DHT94_RS03095 | 636197..636592 | - | 396 | WP_108870557.1 | VOC family protein | - |
| DHT94_RS03100 | 637190..637405 | + | 216 | WP_108870558.1 | ribbon-helix-helix protein, CopG family | - |
| DHT94_RS03105 | 637468..637686 | + | 219 | WP_108872307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DHT94_RS03110 | 638087..640165 | + | 2079 | WP_159087338.1 | ATP-dependent endonuclease | - |
| DHT94_RS03115 | 640413..640718 | - | 306 | WP_108872308.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DHT94_RS03120 | 640724..641074 | - | 351 | WP_108872309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DHT94_RS03125 | 641242..644226 | - | 2985 | WP_108870560.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13272.10 Da Isoelectric Point: 6.4802
>T294434 WP_108872309.1 NZ_LT996886:c641074-640724 [Tessaracoccus timonensis]
MWSVDIELIAGWLASLDNDSREQVVAAIELLEDRGPQLGRPIVDTVSSSRHRNMKELRPGSSGRTELRILFAFDPVREAI
MLIAGDKSGSWKRWYARNIPRADDLFDEHLRRLKGE
MWSVDIELIAGWLASLDNDSREQVVAAIELLEDRGPQLGRPIVDTVSSSRHRNMKELRPGSSGRTELRILFAFDPVREAI
MLIAGDKSGSWKRWYARNIPRADDLFDEHLRRLKGE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|