Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4625284..4625886 | Replicon | chromosome |
| Accession | NZ_LT992502 | ||
| Organism | Enterobacter bugandensis isolate EB-247 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A167J774 |
| Locus tag | DG357_RS22445 | Protein ID | WP_047366784.1 |
| Coordinates | 4625575..4625886 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A167J796 |
| Locus tag | DG357_RS22440 | Protein ID | WP_047366785.1 |
| Coordinates | 4625284..4625574 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG357_RS22425 | 4622782..4623684 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| DG357_RS22430 | 4623681..4624316 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
| DG357_RS22435 | 4624313..4625242 | + | 930 | WP_063437456.1 | formate dehydrogenase accessory protein FdhE | - |
| DG357_RS22440 | 4625284..4625574 | - | 291 | WP_047366785.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DG357_RS22445 | 4625575..4625886 | - | 312 | WP_047366784.1 | hypothetical protein | Toxin |
| DG357_RS22450 | 4626035..4626976 | - | 942 | WP_047366783.1 | fatty acid biosynthesis protein FabY | - |
| DG357_RS22455 | 4627021..4627458 | - | 438 | WP_008501836.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| DG357_RS22460 | 4627455..4628336 | - | 882 | WP_045260235.1 | virulence factor BrkB family protein | - |
| DG357_RS22465 | 4628330..4628929 | - | 600 | WP_045260234.1 | glucose-1-phosphatase | - |
| DG357_RS22470 | 4629017..4629487 | - | 471 | WP_028014878.1 | hypothetical protein | - |
| DG357_RS22475 | 4629484..4630227 | - | 744 | WP_048959977.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12135.13 Da Isoelectric Point: 8.8415
>T294432 WP_047366784.1 NZ_LT992502:c4625886-4625575 [Enterobacter bugandensis]
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPEYGDVIQNTGGLRKIRWLAGGKGKRGGVRVIYFYRTCEFEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHRFQIFLATQPEYGDVIQNTGGLRKIRWLAGGKGKRGGVRVIYFYRTCEFEIRLLLIY
RKGIKDDLSAGEKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A167J774 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A167J796 |