Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 2401852..2402450 | Replicon | chromosome |
Accession | NZ_LT992492 | ||
Organism | Vibrio cholerae strain 4295STDY6534248 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q8KQX9 |
Locus tag | DG169_RS11265 | Protein ID | WP_000118545.1 |
Coordinates | 2401852..2402175 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DG169_RS11270 | Protein ID | WP_000058216.1 |
Coordinates | 2402172..2402450 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG169_RS11235 | 2397565..2397951 | - | 387 | WP_000180225.1 | hypothetical protein | - |
DG169_RS11240 | 2397948..2398520 | - | 573 | WP_139057167.1 | type IV conjugative transfer system lipoprotein TraV | - |
DG169_RS11245 | 2398595..2399884 | - | 1290 | WP_001883765.1 | TraB/VirB10 family protein | - |
DG169_RS11250 | 2399887..2400783 | - | 897 | WP_032467354.1 | type-F conjugative transfer system secretin TraK | - |
DG169_RS11255 | 2400767..2401393 | - | 627 | WP_000667169.1 | hypothetical protein | - |
DG169_RS11260 | 2401390..2401671 | - | 282 | WP_000433889.1 | type IV conjugative transfer system protein TraL | - |
DG169_RS11265 | 2401852..2402175 | + | 324 | WP_000118545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DG169_RS11270 | 2402172..2402450 | + | 279 | WP_000058216.1 | helix-turn-helix domain-containing protein | Antitoxin |
DG169_RS11275 | 2402476..2403111 | - | 636 | WP_000033753.1 | DUF4400 domain-containing protein | - |
DG169_RS11280 | 2403098..2403658 | - | 561 | WP_000546510.1 | hypothetical protein | - |
DG169_RS11285 | 2403668..2405488 | - | 1821 | WP_000661887.1 | conjugative transfer system coupling protein TraD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2310264..2443147 | 132883 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12267.26 Da Isoelectric Point: 9.4705
>T294405 WP_000118545.1 NZ_LT992492:2401852-2402175 [Vibrio cholerae]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGNHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGNHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|