Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 2401853..2402451 | Replicon | chromosome |
| Accession | NZ_LT992488 | ||
| Organism | Vibrio cholerae strain 4295STDY6534232 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q8KQX9 |
| Locus tag | DG176_RS11265 | Protein ID | WP_000118545.1 |
| Coordinates | 2401853..2402176 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DG176_RS11270 | Protein ID | WP_000058216.1 |
| Coordinates | 2402173..2402451 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG176_RS11235 | 2397566..2397952 | - | 387 | WP_000180225.1 | hypothetical protein | - |
| DG176_RS11240 | 2397949..2398521 | - | 573 | WP_139057167.1 | type IV conjugative transfer system lipoprotein TraV | - |
| DG176_RS11245 | 2398596..2399885 | - | 1290 | WP_001883765.1 | TraB/VirB10 family protein | - |
| DG176_RS11250 | 2399888..2400784 | - | 897 | WP_032467354.1 | type-F conjugative transfer system secretin TraK | - |
| DG176_RS11255 | 2400768..2401394 | - | 627 | WP_000667169.1 | hypothetical protein | - |
| DG176_RS11260 | 2401391..2401672 | - | 282 | WP_000433889.1 | type IV conjugative transfer system protein TraL | - |
| DG176_RS11265 | 2401853..2402176 | + | 324 | WP_000118545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG176_RS11270 | 2402173..2402451 | + | 279 | WP_000058216.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DG176_RS11275 | 2402477..2403112 | - | 636 | WP_000033753.1 | DUF4400 domain-containing protein | - |
| DG176_RS11280 | 2403099..2403659 | - | 561 | WP_000546510.1 | hypothetical protein | - |
| DG176_RS11285 | 2403669..2405489 | - | 1821 | WP_000661887.1 | conjugative transfer system coupling protein TraD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2310265..2443148 | 132883 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12267.26 Da Isoelectric Point: 9.4705
>T294367 WP_000118545.1 NZ_LT992488:2401853-2402176 [Vibrio cholerae]
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGNHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
MSWKIDFYDGVEDQILDMPPKIQARMIKLLELMEKHGANLGPPHTESMGDGLFEIRAKAQEGIGRGLFCYLKGNHIYVLH
AFVKKSQKTPKNELNLARDRQKEVQKS
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|