Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 2483439..2483746 | Replicon | chromosome |
Accession | NZ_LT992477 | ||
Organism | Staphylococcus aureus isolate 22_LA_562 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE38_RS12680 | Protein ID | WP_011447039.1 |
Coordinates | 2483439..2483615 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2483607..2483746 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE38_RS12660 | 2478674..2482459 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
DXE38_RS12665 | 2482449..2482601 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE38_RS12670 | 2482648..2482935 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE38_RS12675 | 2482993..2483289 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE38_RS12680 | 2483439..2483615 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 2483607..2483746 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2483607..2483746 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2483607..2483746 | - | 140 | NuclAT_0 | - | Antitoxin |
- | 2483607..2483746 | - | 140 | NuclAT_0 | - | Antitoxin |
DXE38_RS12685 | 2483668..2483775 | - | 108 | WP_001791821.1 | hypothetical protein | - |
DXE38_RS12690 | 2483827..2484081 | + | 255 | WP_000611512.1 | phage holin | - |
DXE38_RS12695 | 2484093..2484848 | + | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
DXE38_RS12700 | 2485039..2485530 | + | 492 | WP_000919350.1 | staphylokinase | - |
DXE38_RS12705 | 2486189..2486539 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE38_RS12710 | 2486592..2486852 | - | 261 | WP_001791826.1 | hypothetical protein | - |
DXE38_RS12720 | 2487163..2487342 | - | 180 | WP_000669789.1 | hypothetical protein | - |
DXE38_RS12725 | 2487664..2487911 | - | 248 | Protein_2377 | sphingomyelin phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / scn | 2436628..2486539 | 49911 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294343 WP_011447039.1 NZ_LT992477:2483439-2483615 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294343 NZ_LT992477:c2483746-2483607 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|