Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2483439..2483777 | Replicon | chromosome |
| Accession | NZ_LT992477 | ||
| Organism | Staphylococcus aureus isolate 22_LA_562 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE38_RS12680 | Protein ID | WP_011447039.1 |
| Coordinates | 2483439..2483615 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2483603..2483777 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE38_RS12660 | 2478674..2482459 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
| DXE38_RS12665 | 2482449..2482601 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE38_RS12670 | 2482648..2482935 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE38_RS12675 | 2482993..2483289 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE38_RS12680 | 2483439..2483615 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 2483603..2483777 | - | 175 | - | - | Antitoxin |
| DXE38_RS12690 | 2483827..2484081 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE38_RS12695 | 2484093..2484848 | + | 756 | WP_064131634.1 | CHAP domain-containing protein | - |
| DXE38_RS12700 | 2485039..2485530 | + | 492 | WP_000919350.1 | staphylokinase | - |
| DXE38_RS12705 | 2486189..2486539 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE38_RS12710 | 2486592..2486852 | - | 261 | WP_001791826.1 | hypothetical protein | - |
| DXE38_RS12720 | 2487163..2487342 | - | 180 | WP_000669789.1 | hypothetical protein | - |
| DXE38_RS12725 | 2487664..2487911 | - | 248 | Protein_2377 | sphingomyelin phosphodiesterase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / scn | 2436628..2486539 | 49911 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294341 WP_011447039.1 NZ_LT992477:2483439-2483615 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294341 NZ_LT992477:c2483777-2483603 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|