Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2310988..2311267 | Replicon | chromosome |
Accession | NZ_LT992477 | ||
Organism | Staphylococcus aureus isolate 22_LA_562 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DXE38_RS11685 | Protein ID | WP_001802298.1 |
Coordinates | 2310988..2311092 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2311088..2311267 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE38_RS11650 | 2306887..2307495 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
DXE38_RS11655 | 2307785..2308567 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DXE38_RS11660 | 2308635..2309492 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DXE38_RS11665 | 2309622..2309714 | - | 93 | WP_000220902.1 | hypothetical protein | - |
DXE38_RS11670 | 2310150..2310308 | - | 159 | WP_001792784.1 | hypothetical protein | - |
DXE38_RS11685 | 2310988..2311092 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2311088..2311267 | - | 180 | - | - | Antitoxin |
DXE38_RS11690 | 2311590..2312681 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
DXE38_RS11695 | 2312947..2313927 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DXE38_RS11700 | 2313929..2314249 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DXE38_RS11705 | 2314401..2315066 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294337 WP_001802298.1 NZ_LT992477:2310988-2311092 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294337 NZ_LT992477:c2311267-2311088 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|