Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 873232..873495 | Replicon | chromosome |
| Accession | NZ_LT992476 | ||
| Organism | Staphylococcus aureus isolate 21_LA_436 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DXE57_RS04490 | Protein ID | WP_001802298.1 |
| Coordinates | 873232..873336 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 873331..873495 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE57_RS04455 | 869131..869739 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
| DXE57_RS04460 | 870029..870811 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| DXE57_RS04465 | 870879..871736 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
| DXE57_RS04470 | 871866..871958 | - | 93 | WP_000220902.1 | hypothetical protein | - |
| DXE57_RS04475 | 872394..872552 | - | 159 | WP_001792784.1 | hypothetical protein | - |
| DXE57_RS04490 | 873232..873336 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 873331..873495 | - | 165 | - | - | Antitoxin |
| DXE57_RS04495 | 873834..874925 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
| DXE57_RS04500 | 875191..876171 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| DXE57_RS04505 | 876173..876493 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DXE57_RS04510 | 876645..877310 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294317 WP_001802298.1 NZ_LT992476:873232-873336 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 165 bp
>AT294317 NZ_LT992476:c873495-873331 [Staphylococcus aureus]
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
GTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGGAAACATGTTACCCTAA
TGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTCAAAGCGAATAGAAGGT
TATTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|