Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 811738..812076 | Replicon | chromosome |
| Accession | NZ_LT992476 | ||
| Organism | Staphylococcus aureus isolate 21_LA_436 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE57_RS04160 | Protein ID | WP_011447039.1 |
| Coordinates | 811738..811914 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 811902..812076 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE57_RS04140 | 806973..810758 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
| DXE57_RS04145 | 810748..810900 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE57_RS04150 | 810947..811234 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE57_RS04155 | 811292..811588 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE57_RS04160 | 811738..811914 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 811902..812076 | - | 175 | - | - | Antitoxin |
| DXE57_RS04170 | 812126..812380 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE57_RS04175 | 812392..813147 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE57_RS04180 | 813338..813829 | + | 492 | WP_000920037.1 | staphylokinase | - |
| DXE57_RS04190 | 814479..814814 | + | 336 | Protein_800 | SH3 domain-containing protein | - |
| DXE57_RS04195 | 814909..815358 | - | 450 | WP_114668899.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE57_RS04200 | 816043..816393 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE57_RS04205 | 816446..816706 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / chp / scn | 774378..820903 | 46525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294314 WP_011447039.1 NZ_LT992476:811738-811914 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294314 NZ_LT992476:c812076-811902 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|