Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2781407..2781591 | Replicon | chromosome |
Accession | NZ_LT992475 | ||
Organism | Staphylococcus aureus isolate 20_LA_415 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | DXE41_RS14450 | Protein ID | WP_000482647.1 |
Coordinates | 2781407..2781514 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2781531..2781591 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE41_RS14425 | 2776764..2777237 | + | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
DXE41_RS14430 | 2777360..2778571 | - | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
DXE41_RS14435 | 2778759..2779418 | - | 660 | WP_000831300.1 | hypothetical protein | - |
DXE41_RS14440 | 2779478..2780620 | - | 1143 | WP_001176859.1 | glycerate kinase | - |
DXE41_RS14445 | 2780887..2781273 | + | 387 | WP_000779355.1 | flippase GtxA | - |
DXE41_RS14450 | 2781407..2781514 | + | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2781531..2781591 | - | 61 | - | - | Antitoxin |
DXE41_RS14460 | 2782218..2783981 | + | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
DXE41_RS14465 | 2784006..2785739 | + | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
DXE41_RS14475 | 2785970..2786137 | + | 168 | WP_001798790.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T294312 WP_000482647.1 NZ_LT992475:2781407-2781514 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT294312 NZ_LT992475:c2781591-2781531 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|