Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 1525645..1526059 Replicon chromosome
Accession NZ_LT992475
Organism Staphylococcus aureus isolate 20_LA_415

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag DXE41_RS08065 Protein ID WP_031867695.1
Coordinates 1525808..1526059 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag DXE41_RS15150 Protein ID WP_000028424.1
Coordinates 1525645..1525818 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE41_RS08015 1521264..1522472 - 1209 WP_001807202.1 PBSX family phage terminase large subunit -
DXE41_RS08020 1522465..1522959 - 495 WP_031867679.1 terminase -
DXE41_RS08030 1523312..1523713 - 402 WP_000286968.1 hypothetical protein -
DXE41_RS08035 1523714..1523887 - 174 WP_025174881.1 transcriptional activator RinB -
DXE41_RS08040 1523887..1524273 - 387 WP_001623479.1 hypothetical protein -
DXE41_RS08045 1524263..1524499 - 237 WP_000608283.1 hypothetical protein -
DXE41_RS08050 1524492..1524695 - 204 WP_000141259.1 hypothetical protein -
DXE41_RS08055 1524692..1524898 - 207 WP_031867680.1 DUF1381 domain-containing protein -
DXE41_RS08060 1524935..1525468 - 534 WP_031807824.1 dUTPase -
DXE41_RS15145 1525483..1525644 - 162 WP_000889682.1 hypothetical protein -
DXE41_RS15150 1525645..1525818 - 174 WP_000028424.1 hypothetical protein Antitoxin
DXE41_RS08065 1525808..1526059 - 252 WP_031867695.1 DUF1024 family protein Toxin
DXE41_RS08070 1526052..1526417 - 366 WP_031765535.1 hypothetical protein -
DXE41_RS08075 1526414..1526816 - 403 Protein_1490 hypothetical protein -
DXE41_RS08080 1526819..1527025 - 207 WP_015994748.1 hypothetical protein -
DXE41_RS08085 1527039..1527728 - 690 WP_015994747.1 N-6 DNA methylase -
DXE41_RS08090 1527725..1527925 - 201 WP_015994746.1 hypothetical protein -
DXE41_RS08095 1527928..1528185 - 258 WP_015994745.1 DUF3310 domain-containing protein -
DXE41_RS08100 1528185..1528544 - 360 WP_031794870.1 phage protein -
DXE41_RS08105 1528672..1528977 - 306 WP_000101252.1 hypothetical protein -
DXE41_RS08110 1528978..1529163 - 186 WP_001187243.1 DUF3113 family protein -
DXE41_RS08115 1529168..1529572 - 405 WP_031872375.1 DUF1064 domain-containing protein -
DXE41_RS08120 1529582..1529803 - 222 WP_001123688.1 DUF3269 family protein -
DXE41_RS08125 1529806..1530021 - 216 WP_031794786.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1495602..1542032 46430


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.31 Da        Isoelectric Point: 3.8051

>T294307 WP_031867695.1 NZ_LT992475:c1526059-1525808 [Staphylococcus aureus]
MNNREQIEKSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT294307 WP_000028424.1 NZ_LT992475:c1525818-1525645 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References