Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 364569..364907 | Replicon | chromosome |
Accession | NZ_LT992475 | ||
Organism | Staphylococcus aureus isolate 20_LA_415 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DXE41_RS02060 | Protein ID | WP_011447039.1 |
Coordinates | 364569..364745 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 364733..364907 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE41_RS02040 | 359804..363589 | + | 3786 | WP_031889405.1 | phage minor structural protein | - |
DXE41_RS02045 | 363579..363731 | + | 153 | WP_001153681.1 | hypothetical protein | - |
DXE41_RS02050 | 363778..364065 | + | 288 | WP_001040261.1 | hypothetical protein | - |
DXE41_RS02055 | 364123..364419 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DXE41_RS02060 | 364569..364745 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
- | 364733..364907 | - | 175 | - | - | Antitoxin |
DXE41_RS02070 | 364957..365211 | + | 255 | WP_000611512.1 | phage holin | - |
DXE41_RS02075 | 365223..365978 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE41_RS02080 | 366169..366660 | + | 492 | WP_000919350.1 | staphylokinase | - |
DXE41_RS02090 | 367310..367645 | + | 336 | Protein_385 | SH3 domain-containing protein | - |
DXE41_RS02095 | 367740..368189 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DXE41_RS02100 | 368874..369224 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DXE41_RS02105 | 369277..369537 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | groEL / hlb / sak / chp / scn | 318250..369224 | 50974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294300 WP_011447039.1 NZ_LT992475:364569-364745 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 175 bp
>AT294300 NZ_LT992475:c364907-364733 [Staphylococcus aureus]
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
ATTTGATATTTATATTATGGTGTGTTAATTTATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCC
GTTAAAAAGACGGTGGCTATTTTAGATTAAAGATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGAT
GGTTATTTTTTATTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|