Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 192669..192948 | Replicon | chromosome |
| Accession | NZ_LT992475 | ||
| Organism | Staphylococcus aureus isolate 20_LA_415 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | DXE41_RS01070 | Protein ID | WP_001802298.1 |
| Coordinates | 192669..192773 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 192769..192948 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE41_RS01035 | 188568..189176 | + | 609 | WP_000101714.1 | TIR domain-containing protein | - |
| DXE41_RS01040 | 189466..190248 | + | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
| DXE41_RS01045 | 190316..191173 | + | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
| DXE41_RS01050 | 191303..191395 | - | 93 | WP_000220902.1 | hypothetical protein | - |
| DXE41_RS01055 | 191831..191989 | - | 159 | WP_001792784.1 | hypothetical protein | - |
| DXE41_RS01070 | 192669..192773 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| - | 192769..192948 | - | 180 | - | - | Antitoxin |
| DXE41_RS01075 | 193271..194362 | - | 1092 | WP_000495673.1 | hypothetical protein | - |
| DXE41_RS01080 | 194628..195608 | - | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
| DXE41_RS01085 | 195610..195930 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| DXE41_RS01090 | 196082..196747 | + | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T294296 WP_001802298.1 NZ_LT992475:192669-192773 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT294296 NZ_LT992475:c192948-192769 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|