Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 2650954..2651261 | Replicon | chromosome |
Accession | NZ_LT992474 | ||
Organism | Staphylococcus aureus isolate 19_LA_388 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A6B5C9Y4 |
Locus tag | DXE66_RS13580 | Protein ID | WP_072357969.1 |
Coordinates | 2651085..2651261 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 2650954..2651093 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE66_RS13525 | 2646298..2646558 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DXE66_RS13530 | 2646611..2646961 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
DXE66_RS13535 | 2647644..2648093 | + | 450 | WP_000727643.1 | chemotaxis-inhibiting protein CHIPS | - |
DXE66_RS13540 | 2648186..2648520 | - | 335 | Protein_2513 | SH3 domain-containing protein | - |
DXE66_RS13560 | 2649170..2649661 | - | 492 | WP_000920041.1 | staphylokinase | - |
DXE66_RS13565 | 2649852..2650607 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DXE66_RS13570 | 2650619..2650873 | - | 255 | WP_000611512.1 | phage holin | - |
DXE66_RS13575 | 2650925..2651032 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- | 2650954..2651093 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2650954..2651093 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2650954..2651093 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2650954..2651093 | + | 140 | NuclAT_0 | - | Antitoxin |
DXE66_RS13580 | 2651085..2651261 | - | 177 | WP_072357969.1 | putative holin-like toxin | Toxin |
DXE66_RS13585 | 2651404..2651778 | - | 375 | WP_000340977.1 | hypothetical protein | - |
DXE66_RS13590 | 2651834..2652121 | - | 288 | WP_001262620.1 | hypothetical protein | - |
DXE66_RS13595 | 2652167..2652319 | - | 153 | WP_001000058.1 | hypothetical protein | - |
DXE66_RS13600 | 2652312..2656094 | - | 3783 | WP_114639804.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2646611..2698085 | 51474 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6863.47 Da Isoelectric Point: 10.6777
>T294287 WP_072357969.1 NZ_LT992474:c2651261-2651085 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294287 NZ_LT992474:2650954-2651093 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|