Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-MW1433/- |
| Location | 2695297..2695604 | Replicon | chromosome |
| Accession | NZ_LT992473 | ||
| Organism | Staphylococcus aureus isolate 14_5418 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | DXE48_RS13685 | Protein ID | WP_011447039.1 |
| Coordinates | 2695297..2695473 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | MW1433 | ||
| Locus tag | - | ||
| Coordinates | 2695465..2695604 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE48_RS13665 | 2690532..2694317 | + | 3786 | WP_000582165.1 | hypothetical protein | - |
| DXE48_RS13670 | 2694307..2694459 | + | 153 | WP_001153681.1 | hypothetical protein | - |
| DXE48_RS13675 | 2694506..2694793 | + | 288 | WP_001040261.1 | hypothetical protein | - |
| DXE48_RS13680 | 2694851..2695147 | + | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| DXE48_RS13685 | 2695297..2695473 | + | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| - | 2695465..2695604 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2695465..2695604 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2695465..2695604 | - | 140 | NuclAT_0 | - | Antitoxin |
| - | 2695465..2695604 | - | 140 | NuclAT_0 | - | Antitoxin |
| DXE48_RS13690 | 2695526..2695633 | - | 108 | WP_001791821.1 | hypothetical protein | - |
| DXE48_RS13695 | 2695685..2695939 | + | 255 | WP_000611512.1 | phage holin | - |
| DXE48_RS13700 | 2695951..2696706 | + | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| DXE48_RS13705 | 2696897..2697388 | + | 492 | WP_000919350.1 | staphylokinase | - |
| DXE48_RS13715 | 2698038..2698373 | + | 336 | Protein_2569 | SH3 domain-containing protein | - |
| DXE48_RS13720 | 2698468..2698917 | - | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| DXE48_RS13725 | 2699602..2699952 | + | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| DXE48_RS13730 | 2700005..2700265 | - | 261 | WP_001791826.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | groEL / hlb / sak / chp / scn | 2648330..2699952 | 51622 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T294278 WP_011447039.1 NZ_LT992473:2695297-2695473 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT294278 NZ_LT992473:c2695604-2695465 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|